PDB entry 2csl

View 2csl on RCSB PDB site
Description: Crystal structure of TTHA0137 from Thermus Thermophilus HB8
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-22, released 2005-11-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein translation intiation inhibitor
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM06 (0-123)
      • modified residue (0)
      • modified residue (52)
      • modified residue (79)
    Domains in SCOP 1.73: d2csla1
  • Chain 'B':
    Compound: protein translation intiation inhibitor
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM06 (0-123)
      • modified residue (0)
      • modified residue (52)
      • modified residue (79)
    Domains in SCOP 1.73: d2cslb1
  • Chain 'C':
    Compound: protein translation intiation inhibitor
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM06 (0-123)
      • modified residue (0)
      • modified residue (52)
      • modified residue (79)
    Domains in SCOP 1.73: d2cslc1
  • Chain 'D':
    Compound: protein translation intiation inhibitor
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM06 (0-123)
      • modified residue (0)
      • modified residue (52)
      • modified residue (79)
    Domains in SCOP 1.73: d2csld1
  • Chain 'E':
    Compound: protein translation intiation inhibitor
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM06 (0-123)
      • modified residue (0)
      • modified residue (52)
      • modified residue (79)
    Domains in SCOP 1.73: d2csle1
  • Chain 'F':
    Compound: protein translation intiation inhibitor
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM06 (0-123)
      • modified residue (0)
      • modified residue (52)
      • modified residue (79)
    Domains in SCOP 1.73: d2cslf1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cslA (A:)
    meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
    eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
    alae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cslB (B:)
    meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
    eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
    alae
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cslC (C:)
    meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
    eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
    alae
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cslD (D:)
    meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
    eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
    alae
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cslE (E:)
    meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
    eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
    alae
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cslF (F:)
    meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
    eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
    alae