SCOPe 2.07: Domain d2csld_: 2csl D:

Lineage for d2csld_ (2csl D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (3 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein automated matches [190254] (5 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187037] (1 PDB entry)

8. Domain d2csld_: 2csl D: [130775]
   Other proteins in same PDB: d2csla1
   automated match to d1xrga_

Details for d2csld_

PDB Entry: 2csl, 2.5 Å

PDB Description: Crystal structure of TTHA0137 from Thermus Thermophilus HB8

PDB Compounds: (D:) protein translation initiation inhibitor

SCOPe Domain Sequences for d2csld_:

Sequence; same for both SEQRES and ATOM records:

>d2csld_ d.79.1.1 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
alae

Timeline for d2csld_:

• d2csld_ first appeared in SCOP 1.73, called d2csld1
  
• d2csld_ appears in SCOPe 2.06
  
• d2csld_ appears in the current release, SCOPe 2.08