SCOPe 2.06: Domain d2co6a_: 2co6 A:

Lineage for d2co6a_ (2co6 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein automated matches [190569] (10 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [187563] (2 PDB entries)

8. Domain d2co6a_: 2co6 A: [130668]
   Other proteins in same PDB: d2co6b1, d2co6b2
   automated match to d2co7a1

Details for d2co6a_

PDB Entry: 2co6, 2 Å

PDB Description: salmonella enterica safa pilin in complex with the safb chaperone (type i)

PDB Compounds: (A:) putative outer membrane protein

SCOPe Domain Sequences for d2co6a_:

Sequence; same for both SEQRES and ATOM records:

>d2co6a_ b.2.3.2 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
gsdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagk
ntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldv
vgyqp

Timeline for d2co6a_:

• d2co6a_ first appeared in SCOP 1.73, called d2co6a1
  
• d2co6a_ appears in SCOPe 2.05
  
• d2co6a_ appears in SCOPe 2.07
  
• d2co6a_ appears in the current release, SCOPe 2.08