Lineage for d2co6a_ (2co6 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040523Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2040677Protein automated matches [190569] (10 species)
    not a true protein
  7. 2040764Species Salmonella typhimurium [TaxId:99287] [187563] (2 PDB entries)
  8. 2040766Domain d2co6a_: 2co6 A: [130668]
    Other proteins in same PDB: d2co6b1, d2co6b2
    automated match to d2co7a1

Details for d2co6a_

PDB Entry: 2co6 (more details), 2 Å

PDB Description: salmonella enterica safa pilin in complex with the safb chaperone (type i)
PDB Compounds: (A:) putative outer membrane protein

SCOPe Domain Sequences for d2co6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2co6a_ b.2.3.2 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
gsdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagk
ntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldv
vgyqp

SCOPe Domain Coordinates for d2co6a_:

Click to download the PDB-style file with coordinates for d2co6a_.
(The format of our PDB-style files is described here.)

Timeline for d2co6a_: