Lineage for d2cn1a1 (2cn1 A:14-286)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848339Family c.108.1.21: Pyrimidine 5'-nucleotidase (UMPH-1) [142183] (1 protein)
    Pfam PF05822; the insertion subdomain is a rudiment 4-helical bundle
  6. 848340Protein Cytosolic 5'-nucleotidase III [142184] (2 species)
  7. 848341Species Human (Homo sapiens) [TaxId:9606] [142185] (2 PDB entries)
    Uniprot Q9H0P0 64-336
  8. 848343Domain d2cn1a1: 2cn1 A:14-286 [130633]

Details for d2cn1a1

PDB Entry: 2cn1 (more details), 2.67 Å

PDB Description: crystal structure of human cytosolic 5'-nucleotidase iii (nt5c3)(casp target)
PDB Compounds: (A:) Cytosolic 5'-nucleotidase III

SCOP Domain Sequences for d2cn1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cn1a1 c.108.1.21 (A:14-286) Cytosolic 5'-nucleotidase III {Human (Homo sapiens) [TaxId: 9606]}
nptrveeiicglikggaaklqiitdfdmtlsrfsykgkrcptchniidncklvtdecrkk
llqlkekyyaievdpvltveekypymvewytkshgllvqqalpkaklkeivaesdvmlke
gyenffdklqqhsipvfifsagigdvleevirqagvyhpnvkvvsnfmdfdetgvlkgfk
gelihvfnkhdgalrnteyfnqlkdnsniillgdsqgdlrmadgvanvehilkigylndr
vdellekymdsydivlvqdeslevansilqkil

SCOP Domain Coordinates for d2cn1a1:

Click to download the PDB-style file with coordinates for d2cn1a1.
(The format of our PDB-style files is described here.)

Timeline for d2cn1a1: