Lineage for d2cm2a2 (2cm2 A:2-283)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875255Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2875600Protein automated matches [190252] (5 species)
    not a true protein
  7. 2875603Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries)
  8. 2875606Domain d2cm2a2: 2cm2 A:2-283 [130610]
    Other proteins in same PDB: d2cm2a3
    automated match to d1bzja_
    complexed with mpd

Details for d2cm2a2

PDB Entry: 2cm2 (more details), 1.5 Å

PDB Description: structure of protein tyrosine phosphatase 1b (p212121)
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d2cm2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cm2a2 c.45.1.2 (A:2-283) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg

SCOPe Domain Coordinates for d2cm2a2:

Click to download the PDB-style file with coordinates for d2cm2a2.
(The format of our PDB-style files is described here.)

Timeline for d2cm2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cm2a3