Class b: All beta proteins [48724] (174 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) two constituent families are related by circular permutation |
Family b.7.1.1: PLC-like (P variant) [49563] (11 proteins) |
Protein Unc-13 homolog A [141105] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [141106] (2 PDB entries) Uniprot Q62768 1-128! Uniprot Q62768 2-150 |
Domain d2cjtb1: 2cjt B:1-128 [130550] automatically matched to 2CJT A:1-128 complexed with edo, fmt |
PDB Entry: 2cjt (more details), 1.44 Å
SCOP Domain Sequences for d2cjtb1:
Sequence, based on SEQRES records: (download)
>d2cjtb1 b.7.1.1 (B:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} msllcvgvkkakfdgaqekfntyvtlkvqnvksttiavrgsqpsweqdfmfeinrldlgl tvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimadseicgtkdptfhr illdahfe
>d2cjtb1 b.7.1.1 (B:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} msllcvgvkkakfdgaqekfntyvtlkvqnvksttiavrgsqpsweqdfmfeinrldlgl tvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsgtkdptfhrilldahfe
Timeline for d2cjtb1: