SCOP 1.73: Domain d2cjtb1: 2cjt B:1-128

Lineage for d2cjtb1 (2cjt B:1-128)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.7: C2 domain-like [49561] (4 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families)
   two constituent families are related by circular permutation

5. Family b.7.1.1: PLC-like (P variant) [49563] (8 proteins)

6. Protein Unc-13 homolog A [141105] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [141106] (2 PDB entries)

8. Domain d2cjtb1: 2cjt B:1-128 [130550]
   automatically matched to 2CJT A:1-128
   complexed with edo, fmt

Details for d2cjtb1

PDB Entry: 2cjt, 1.44 Å

PDB Description: structural basis for a munc13-1 homodimer - munc13-1 - rim heterodimer switch: c2-domains as versatile protein-protein interaction modules

PDB Compounds: (B:) unc-13 homolog a

SCOP Domain Sequences for d2cjtb1:

Sequence, based on SEQRES records:

>d2cjtb1 b.7.1.1 (B:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]}
msllcvgvkkakfdgaqekfntyvtlkvqnvksttiavrgsqpsweqdfmfeinrldlgl
tvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimadseicgtkdptfhr
illdahfe

Sequence, based on observed residues (ATOM records):

>d2cjtb1 b.7.1.1 (B:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]}
msllcvgvkkakfdgaqekfntyvtlkvqnvksttiavrgsqpsweqdfmfeinrldlgl
tvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsgtkdptfhrilldahfe

Timeline for d2cjtb1:

• d2cjtb1 is new in SCOP 1.73
  
• d2cjtb1 appears in SCOP 1.75
  
• d2cjtb1 appears in the current release, SCOPe 2.08, called d2cjtb_