SCOP 1.73: Domain d2cjja1: 2cjj A:8-70

Lineage for d2cjja1 (2cjj A:8-70)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (17 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (13 proteins)

6. Protein Radialis [140167] (1 species)
   stand-alone Myb/SANT domain

7. Species Garden snapdragon (Antirrhinum majus) [TaxId:4151] [140168] (1 PDB entry)

8. Domain d2cjja1: 2cjj A:8-70 [130540]

Details for d2cjja1

PDB Entry: 2cjj, 1.9 Å

PDB Description: crystal structure of the myb domain of the rad transcription factor from antirrhinum majus

PDB Compounds: (A:) radialis

SCOP Domain Sequences for d2cjja1:

Sequence; same for both SEQRES and ATOM records:

>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]}
grpwsakenkaferalavydkdtpdrwanvaravegrtpeevkkhyeilvedikyiesgk
vpf

Timeline for d2cjja1:

• d2cjja1 is new in SCOP 1.73
  
• d2cjja1 appears in SCOP 1.75
  
• d2cjja1 appears in the current release, SCOPe 2.08