Lineage for d2cjja1 (2cjj A:8-70)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692037Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 2692086Protein Radialis [140167] (1 species)
    stand-alone Myb/SANT domain
  7. 2692087Species Garden snapdragon (Antirrhinum majus) [TaxId:4151] [140168] (1 PDB entry)
    Uniprot Q58FS3 8-70
  8. 2692088Domain d2cjja1: 2cjj A:8-70 [130540]

Details for d2cjja1

PDB Entry: 2cjj (more details), 1.9 Å

PDB Description: crystal structure of the myb domain of the rad transcription factor from antirrhinum majus
PDB Compounds: (A:) radialis

SCOPe Domain Sequences for d2cjja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]}
grpwsakenkaferalavydkdtpdrwanvaravegrtpeevkkhyeilvedikyiesgk
vpf

SCOPe Domain Coordinates for d2cjja1:

Click to download the PDB-style file with coordinates for d2cjja1.
(The format of our PDB-style files is described here.)

Timeline for d2cjja1: