![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
![]() | Protein Radialis [140167] (1 species) stand-alone Myb/SANT domain |
![]() | Species Garden snapdragon (Antirrhinum majus) [TaxId:4151] [140168] (1 PDB entry) Uniprot Q58FS3 8-70 |
![]() | Domain d2cjja1: 2cjj A:8-70 [130540] |
PDB Entry: 2cjj (more details), 1.9 Å
SCOPe Domain Sequences for d2cjja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} grpwsakenkaferalavydkdtpdrwanvaravegrtpeevkkhyeilvedikyiesgk vpf
Timeline for d2cjja1: