Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101440] (26 PDB entries) Uniprot O76074 534-860 |
Domain d2chma1: 2chm A:537-858 [130472] complexed with 3p4, mes, mg, zn |
PDB Entry: 2chm (more details), 1.6 Å
SCOPe Domain Sequences for d2chma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chma1 a.211.1.2 (A:537-858) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]} trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld hpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlki ikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpiq qriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthv sedcfplldgcrknrqkwqalae
Timeline for d2chma1: