SCOPe 2.08: Domain d2ch7b1: 2ch7 B:226-529

Lineage for d2ch7b1 (2ch7 B:226-529)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.5: Methyl-accepting chemotaxis protein (MCP) signaling domain [58104] (1 family)

5. Family h.4.5.1: Methyl-accepting chemotaxis protein (MCP) signaling domain [58105] (2 proteins)

6. Protein Methyl-accepting chemotaxis protein 2, MCP2 [144290] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [144291] (1 PDB entry)
   Uniprot Q9X0M7 225-529

8. Domain d2ch7b1: 2ch7 B:226-529 [130470]
   Other proteins in same PDB: d2ch7b2
   complexed with pb

Details for d2ch7b1

PDB Entry: 2ch7, 2.5 Å

PDB Description: crystal structure of the cytoplasmic domain of a bacterial chemoreceptor from thermotoga maritima

PDB Compounds: (B:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d2ch7b1:

Sequence; same for both SEQRES and ATOM records:

>d2ch7b1 h.4.5.1 (B:226-529) Methyl-accepting chemotaxis protein 2, MCP2 {Thermotoga maritima [TaxId: 2336]}
dvqtetfsvaesieeiskaneeitnqllgiskemdnistriesisasvqettagseeiss
atkniadsaqqaasfadqstqlakeagdalkkvievtrmisnsakdvervvesfqkgaee
itsfvetinaiaeqtnllalnaaieaarageagrgfavvadeirklaeesqqasenvrrv
vneirsiaedagkvsseitarveegtkladeadeklnsivgaverinemlqniaaaieeq
naavdeittamtenaknaeeitnsvkevnarlqeisasteevtsrvqtirenvqmlkeiv
aryk

Timeline for d2ch7b1:

• d2ch7b1 first appeared in SCOP 1.73
  
• d2ch7b1 appears in SCOPe 2.07