![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
![]() | Superfamily h.4.5: Methyl-accepting chemotaxis protein (MCP) signaling domain [58104] (1 family) ![]() |
![]() | Family h.4.5.1: Methyl-accepting chemotaxis protein (MCP) signaling domain [58105] (2 proteins) |
![]() | Protein Methyl-accepting chemotaxis protein 2, MCP2 [144290] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [144291] (1 PDB entry) Uniprot Q9X0M7 225-529 |
![]() | Domain d2ch7b1: 2ch7 B:226-529 [130470] Other proteins in same PDB: d2ch7b2 complexed with pb |
PDB Entry: 2ch7 (more details), 2.5 Å
SCOPe Domain Sequences for d2ch7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ch7b1 h.4.5.1 (B:226-529) Methyl-accepting chemotaxis protein 2, MCP2 {Thermotoga maritima [TaxId: 2336]} dvqtetfsvaesieeiskaneeitnqllgiskemdnistriesisasvqettagseeiss atkniadsaqqaasfadqstqlakeagdalkkvievtrmisnsakdvervvesfqkgaee itsfvetinaiaeqtnllalnaaieaarageagrgfavvadeirklaeesqqasenvrrv vneirsiaedagkvsseitarveegtkladeadeklnsivgaverinemlqniaaaieeq naavdeittamtenaknaeeitnsvkevnarlqeisasteevtsrvqtirenvqmlkeiv aryk
Timeline for d2ch7b1: