Lineage for d2cg7a2 (2cg7 A:62-108)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064849Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 1064850Superfamily g.27.1: FnI-like domain [57603] (2 families) (S)
  5. 1064851Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 1064852Protein Fibronectin [57605] (1 species)
  7. 1064853Species Human (Homo sapiens) [TaxId:9606] [57606] (13 PDB entries)
  8. 1064855Domain d2cg7a2: 2cg7 A:62-108 [130424]
    automatically matched to d1o9aa2

Details for d2cg7a2

PDB Entry: 2cg7 (more details), 1.2 Å

PDB Description: second and third fibronectin type i module pair (crystal form ii).
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d2cg7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cg7a2 g.27.1.1 (A:62-108) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
aeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctian

SCOPe Domain Coordinates for d2cg7a2:

Click to download the PDB-style file with coordinates for d2cg7a2.
(The format of our PDB-style files is described here.)

Timeline for d2cg7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cg7a1