SCOPe 2.06: Domain d2cg6a1: 2cg6 A:109-151

Lineage for d2cg6a1 (2cg6 A:109-151)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (3 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
   automatically mapped to Pfam PF00039

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries)

8. Domain d2cg6a1: 2cg6 A:109-151 [130421]
   complexed with so4

Details for d2cg6a1

PDB Entry: 2cg6, 1.55 Å

PDB Description: second and third fibronectin type i module pair (crystal form i).

PDB Compounds: (A:) human fibronectin

SCOPe Domain Sequences for d2cg6a1:

Sequence; same for both SEQRES and ATOM records:

>d2cg6a1 g.27.1.1 (A:109-151) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
rcheggqsykigdtwrrphetggymlecvclgngkgewtckpi

Timeline for d2cg6a1:

• d2cg6a1 first appeared in SCOP 1.73
  
• d2cg6a1 appears in SCOPe 2.05
  
• d2cg6a1 appears in SCOPe 2.07
  
• d2cg6a1 appears in the current release, SCOPe 2.08