Lineage for d2cfba1 (2cfb A:19-411)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131830Protein Glutamate-1-semialdehyde aminomutase (aminotransferase) [53420] (2 species)
  7. 2131831Species Synechococcus elongatus [TaxId:32046] [142669] (1 PDB entry)
    Uniprot Q8DLK8 45-437
  8. 2131832Domain d2cfba1: 2cfb A:19-411 [130368]
    complexed with plr

Details for d2cfba1

PDB Entry: 2cfb (more details), 2.85 Å

PDB Description: glutamate-1-semialdehyde 2,1-aminomutase from thermosynechococcus elongatus
PDB Compounds: (A:) Glutamate-1-semialdehyde 2,1-aminomutase

SCOPe Domain Sequences for d2cfba1:

Sequence, based on SEQRES records: (download)

>d2cfba1 c.67.1.4 (A:19-411) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus elongatus [TaxId: 32046]}
pivfdhvkgahiwdvdgnqyidyvgswgpaivghahpevidalhaalekgtsfgapclle
nilaemviaavpsvemvrfvnsgteacmavlrlmraytqrekvikfegcyhghadmflvk
agsgvatlglpdspgvpkattaatltapyndleavsrlfeqypndiagvilepvvgnagf
ippdagfleglreltkqygallvfdevmtgfriayggaqekfgvtpdlttlgkviggglp
vgayggraeimkmvapagpvyqagtlsgnplamtagiktleilsrpgsyehldritgklv
qglldaarefghevcgghisgmfglfftagpvtnyeqakqsdlkkfaafhrgmleqgiyl
apsqfeagftslahteadiertiaaartvlsql

Sequence, based on observed residues (ATOM records): (download)

>d2cfba1 c.67.1.4 (A:19-411) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus elongatus [TaxId: 32046]}
pivfdhvkgahiwdvdgnqyidyvgswgpaivghahpevidalhaalekgtsfgapclle
nilaemviaavpsvemvrfvnsgteacmavlrlmraytqrekvikfegcyhghaatltap
yndleavsrlfeqypndiagvilepvvgnagfippdagfleglreltkqygallvfdevm
tgfriayggaqekfgvtpdlttlgkviggglpvgayggraeimkmvapagptlsgnplam
tagiktleilsrpgsyehldritgklvqglldaarefghevcgghisgmfglfftagpvt
nyeqakqsdlkkfaafhrgmleqgiylapsqfeagftslahteadiertiaaartvlsql

SCOPe Domain Coordinates for d2cfba1:

Click to download the PDB-style file with coordinates for d2cfba1.
(The format of our PDB-style files is described here.)

Timeline for d2cfba1: