SCOPe 2.08: Domain d2ce9c2: 2ce9 C:443-770

Lineage for d2ce9c2 (2ce9 C:443-770)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.1: WD40-repeat [50979] (17 proteins)
   this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain

6. Protein Groucho/tle1, C-terminal domain [75009] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75010] (4 PDB entries)

8. Domain d2ce9c2: 2ce9 C:443-770 [130330]
   Other proteins in same PDB: d2ce9a3, d2ce9b3, d2ce9c3, d2ce9d3
   automated match to d1gxra_
   has additional insertions and/or extensions that are not grouped together

Details for d2ce9c2

PDB Entry: 2ce9, 2.12 Å

PDB Description: a wrpw peptide bound to the groucho-tle wd40 domain.

PDB Compounds: (C:) transducin-like enhancer protein 1

SCOPe Domain Sequences for d2ce9c2:

Sequence; same for both SEQRES and ATOM records:

>d2ce9c2 b.69.4.1 (C:443-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhvytg
gkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlaap
tprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgasci
disndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnve
vlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssv
lscdisvddkyivtgsgdkkatvyeviy

Timeline for d2ce9c2:

• d2ce9c2 first appeared in SCOP 1.73, called d2ce9c1
  
• d2ce9c2 appears in SCOPe 2.07