Lineage for d2ce9d2 (2ce9 D:443-770)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. Family b.69.4.1: WD40-repeat [50979] (17 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. Protein Groucho/tle1, C-terminal domain [75009] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [75010] (4 PDB entries)
  8. Domain d2ce9d2: 2ce9 D:443-770 [130331]
    Other proteins in same PDB: d2ce9a3, d2ce9b3, d2ce9c3, d2ce9d3
    automated match to d1gxra_
    has additional insertions and/or extensions that are not grouped together

Details for d2ce9d2

PDB Entry: 2ce9 (more details), 2.12 Å

PDB Description: a wrpw peptide bound to the groucho-tle wd40 domain.
PDB Compounds: (D:) transducin-like enhancer protein 1

SCOPe Domain Sequences for d2ce9d2:

Sequence, based on SEQRES records: (download)

>d2ce9d2 b.69.4.1 (D:443-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhvytg
gkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlaap
tprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgasci
disndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnve
vlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssv
lscdisvddkyivtgsgdkkatvyeviy

Sequence, based on observed residues (ATOM records): (download)

>d2ce9d2 b.69.4.1 (D:443-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpaysfhvmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhvytggkgcv
kvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlaaptprik
aeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgascidisnd
gtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnvevlhvn
kpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssvlscdi
svddkyivtgsgdkkatvyeviy

SCOPe Domain Coordinates for d2ce9d2 are not available.

Timeline for d2ce9d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ce9d3
View in 3D
Domains from other chains:
(mouse over for more information)
d2ce9a2, d2ce9a3, d2ce9b2, d2ce9b3, d2ce9c2, d2ce9c3