SCOP 1.73: Domain d2ce7f1: 2ce7 F:412-603

Lineage for d2ce7f1 (2ce7 F:412-603)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
   array of 6 helices and a 2-stranded beta-ribbon

4. Superfamily a.269.1: FtsH protease domain-like [140990] (1 family)
   contains zincin-like (scop_sf 55486) metal-binding motif HExxH, embedded into a topologically different fold

5. Family a.269.1.1: FtsH protease domain-like [140991] (1 protein)
   Pfam PF01434; Peptidase family M41

6. Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [140994] (2 PDB entries)

8. Domain d2ce7f1: 2ce7 F:412-603 [130322]
   Other proteins in same PDB: d2ce7a2, d2ce7b2, d2ce7c2, d2ce7d2, d2ce7e2, d2ce7f2
   automatically matched to 2CE7 A:411-603
   complexed with adp, mg, zn; mutant

Details for d2ce7f1

PDB Entry: 2ce7, 2.44 Å

PDB Description: edta treated

PDB Compounds: (F:) cell division protein ftsh

SCOP Domain Sequences for d2ce7f1:

Sequence, based on SEQRES records:

>d2ce7f1 a.269.1.1 (F:412-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
ispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrne
lldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgkeeq
evflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleket
iegdelrrilse

Sequence, based on observed residues (ATOM records):

>d2ce7f1 a.269.1.1 (F:412-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
ispaekriiayheaghavvstvvpngepvhrisiiprgykalgylvsrnelldkltallg
graaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgrnyseevaskidee
vkkivtncyerakeiirkyrkqldniveilleketiegdelrrilse

Timeline for d2ce7f1:

• d2ce7f1 is new in SCOP 1.73
  
• d2ce7f1 appears in SCOP 1.75
  
• d2ce7f1 appears in the current release, SCOPe 2.08