SCOP 1.73: Domain d2ce7c2: 2ce7 C:150-402

Lineage for d2ce7c2 (2ce7 C:150-402)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein AAA domain of cell division protein FtsH [82418] (3 species)
   ATP-dependent protease

7. Species Thermotoga maritima [TaxId:2336] [142325] (2 PDB entries)

8. Domain d2ce7c2: 2ce7 C:150-402 [130317]
   Other proteins in same PDB: d2ce7a1, d2ce7b1, d2ce7c1, d2ce7d1, d2ce7e1, d2ce7f1
   automatically matched to 2CE7 A:150-402
   complexed with adp, mg, zn; mutant

Details for d2ce7c2

PDB Entry: 2ce7, 2.44 Å

PDB Description: edta treated

PDB Compounds: (C:) cell division protein ftsh

SCOP Domain Sequences for d2ce7c2:

Sequence, based on SEQRES records:

>d2ce7c2 c.37.1.20 (C:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhr
gaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvd
ppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdki
tmkdfeeaidrvi

Sequence, based on observed residues (ATOM records):

>d2ce7c2 c.37.1.20 (C:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgreq
tlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkilei
htrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrvi

Timeline for d2ce7c2:

• d2ce7c2 is new in SCOP 1.73
  
• d2ce7c2 appears in SCOP 1.75
  
• d2ce7c2 appears in the current release, SCOPe 2.08