SCOPe 2.01: Domain d2ccua_: 2ccu A:

Lineage for d2ccua_ (2ccu A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (34 PDB entries)

8. Domain d2ccua_: 2ccu A: [130257]
   automated match to d1osfa_
   complexed with 2d9

Details for d2ccua_

PDB Entry: 2ccu, 2.7 Å

PDB Description: human hsp90 with 4-chloro-6-(4-(4-(4-methanesulphonyl-benzyl)- pierazin-1-yl)-1h-pyrazol-3-yl)-benzene-1,3-diol

PDB Compounds: (A:) heat shock protein hsp-90 alpha

SCOPe Domain Sequences for d2ccua_:

Sequence; same for both SEQRES and ATOM records:

>d2ccua_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

Timeline for d2ccua_:

• d2ccua_ first appeared in SCOP 1.73, called d2ccua1
  
• d2ccua_ was called d2ccua1 in SCOP 1.75
  
• d2ccua_ appears in SCOPe 2.02
  
• d2ccua_ appears in the current release, SCOPe 2.08