SCOPe 2.08: Domain d2cbjb3: 2cbj B:40-178

Lineage for d2cbjb3 (2cbj B:40-178)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)

6. Protein Hyaluronidase N-terminal domain [143619] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries)
   Uniprot Q8XL08 41-178

8. Domain d2cbjb3: 2cbj B:40-178 [130190]
   Other proteins in same PDB: d2cbja1, d2cbja2, d2cbjb1, d2cbjb2
   automated match to d2cbia3
   complexed with cl, oan

Details for d2cbjb3

PDB Entry: 2cbj, 2.35 Å

PDB Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase in complex with pugnac

PDB Compounds: (B:) hyaluronidase

SCOPe Domain Sequences for d2cbjb3:

Sequence; same for both SEQRES and ATOM records:

>d2cbjb3 d.92.2.3 (B:40-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt

Timeline for d2cbjb3:

• d2cbjb3 first appeared in SCOP 1.73
  
• d2cbjb3 appears in SCOPe 2.07