Lineage for d2cbjb3 (2cbj B:41-178)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729626Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 729685Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 729693Protein Hyaluronidase N-terminal domain [143619] (1 species)
  7. 729694Species Clostridium perfringens [TaxId:1502] [143620] (2 PDB entries)
  8. 729698Domain d2cbjb3: 2cbj B:41-178 [130190]
    Other proteins in same PDB: d2cbja1, d2cbja2, d2cbjb1, d2cbjb2
    automatically matched to 2CBI A:41-178
    complexed with cl, oan

Details for d2cbjb3

PDB Entry: 2cbj (more details), 2.35 Å

PDB Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase in complex with pugnac
PDB Compounds: (B:) hyaluronidase

SCOP Domain Sequences for d2cbjb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbjb3 d.92.2.3 (B:41-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]}
vlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendpn
sttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtfk
qlvkesnipevnitdypt

SCOP Domain Coordinates for d2cbjb3:

Click to download the PDB-style file with coordinates for d2cbjb3.
(The format of our PDB-style files is described here.)

Timeline for d2cbjb3: