SCOPe 2.06: Domain d2cbib2: 2cbi B:179-495

Lineage for d2cbib2 (2cbi B:179-495)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
   Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain

6. Protein Hyaluronidase catalytic domain [141792] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [141793] (7 PDB entries)
   Uniprot Q8XL08 179-495

8. Domain d2cbib2: 2cbi B:179-495 [130183]
   Other proteins in same PDB: d2cbia1, d2cbia3, d2cbib1, d2cbib3
   automated match to d2cbia2
   complexed with cl, gbl, gol, so4, zn

Details for d2cbib2

PDB Entry: 2cbi, 2.25 Å

PDB Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase

PDB Compounds: (B:) hyaluronidase

SCOPe Domain Sequences for d2cbib2:

Sequence; same for both SEQRES and ATOM records:

>d2cbib2 c.1.8.10 (B:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiynrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr

Timeline for d2cbib2:

• d2cbib2 first appeared in SCOP 1.73
  
• d2cbib2 appears in SCOPe 2.05
  
• d2cbib2 appears in SCOPe 2.07
  
• d2cbib2 appears in the current release, SCOPe 2.08