Lineage for d2caia2 (2cai A:4-84)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225080] (3 PDB entries)
  8. 1370280Domain d2caia2: 2cai A:4-84 [130156]
    Other proteins in same PDB: d2caia1, d2caib1
    automated match to d2f8fa2
    complexed with bme, pg4, so4; mutant

Details for d2caia2

PDB Entry: 2cai (more details), 2.26 Å

PDB Description: structure of glutathione-s-transferase mutant, r21l, from schistosoma haematobium
PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2caia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2caia2 c.47.1.0 (A:4-84) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
dhikviyfngrgraesilmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
hvkwmveslaiarymakkhhm

SCOPe Domain Coordinates for d2caia2:

Click to download the PDB-style file with coordinates for d2caia2.
(The format of our PDB-style files is described here.)

Timeline for d2caia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2caia1