Lineage for d2caia2 (2cai A:4-84)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699243Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 699254Protein Class alpha GST [81360] (8 species)
  7. 699255Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89704] (8 PDB entries)
  8. 699267Domain d2caia2: 2cai A:4-84 [130156]
    Other proteins in same PDB: d2caia1, d2caib1
    automatically matched to d1oe8b2
    complexed with bme, pg4, so4; mutant

Details for d2caia2

PDB Entry: 2cai (more details), 2.26 Å

PDB Description: structure of glutathione-s-transferase mutant, r21l, from schistosoma haematobium
PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOP Domain Sequences for d2caia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2caia2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
dhikviyfngrgraesilmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
hvkwmveslaiarymakkhhm

SCOP Domain Coordinates for d2caia2:

Click to download the PDB-style file with coordinates for d2caia2.
(The format of our PDB-style files is described here.)

Timeline for d2caia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2caia1