![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.1: RNI-like [52047] (4 families) ![]() regular structure consisting of similar repeats |
![]() | Family c.10.1.2: Rna1p (RanGAP1), N-terminal domain [52052] (1 protein) this is a repeat family; one repeat unit is 1k5d C:168-196 found in domain |
![]() | Protein Rna1p (RanGAP1), N-terminal domain [52053] (1 species) GTPase-activating protein for SpI1, ortologue of Ran duplication: consists of 11 repeats |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [52054] (4 PDB entries) |
![]() | Domain d2ca6b_: 2ca6 B: [130152] automated match to d1k5dc_ complexed with so4 |
PDB Entry: 2ca6 (more details), 2.2 Å
SCOPe Domain Sequences for d2ca6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ca6b_ c.10.1.2 (B:) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee
Timeline for d2ca6b_: