Lineage for d2ca5a1 (2ca5 A:20-78)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633814Superfamily a.2.20: MxiH-like [140129] (1 family) (S)
    Type III secretion system needle
  5. 633815Family a.2.20.1: MxiH-like [140130] (2 proteins)
  6. 633819Protein MxiH needle protein [140131] (1 species)
  7. 633820Species Shigella flexneri [TaxId:623] [140132] (1 PDB entry)
  8. 633821Domain d2ca5a1: 2ca5 A:20-78 [130149]
    complexed with gol, ipa, na

Details for d2ca5a1

PDB Entry: 2ca5 (more details), 2.1 Å

PDB Description: mxih needle protein of shigella flexneri (monomeric form, residues 1-78)
PDB Compounds: (A:) mxih

SCOP Domain Sequences for d2ca5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ca5a1 a.2.20.1 (A:20-78) MxiH needle protein {Shigella flexneri [TaxId: 623]}
ddgtqtlqgeltlaldklaknpsnpqllaeyqsklseytlyrnaqsntvkvikdvdaai

SCOP Domain Coordinates for d2ca5a1:

Click to download the PDB-style file with coordinates for d2ca5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ca5a1: