![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.20: MxiH-like [140129] (2 families) ![]() Type III secretion system needle |
![]() | Family a.2.20.1: MxiH-like [140130] (3 proteins) |
![]() | Protein MxiH needle protein [140131] (1 species) |
![]() | Species Shigella flexneri [TaxId:623] [140132] (1 PDB entry) Uniprot P0A223 20-78 |
![]() | Domain d2ca5a1: 2ca5 A:20-78 [130149] Other proteins in same PDB: d2ca5a2, d2ca5b_ complexed with gol, ipa, na |
PDB Entry: 2ca5 (more details), 2.1 Å
SCOPe Domain Sequences for d2ca5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ca5a1 a.2.20.1 (A:20-78) MxiH needle protein {Shigella flexneri [TaxId: 623]} ddgtqtlqgeltlaldklaknpsnpqllaeyqsklseytlyrnaqsntvkvikdvdaai
Timeline for d2ca5a1: