![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein) automatically mapped to Pfam PF04234 automatically mapped to Pfam PF13205 |
![]() | Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species) |
![]() | Species Pseudomonas syringae [TaxId:323] [187019] (2 PDB entries) |
![]() | Domain d2c9qa_: 2c9q A: [130138] automated match to d1m42a_ complexed with cu |
PDB Entry: 2c9q (more details), 1.6 Å
SCOPe Domain Sequences for d2c9qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9qa_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 323]} hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk
Timeline for d2c9qa_: