SCOPe 2.04: Domain d2c80b2: 2c80 B:4-84

Lineage for d2c80b2 (2c80 B:4-84)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89704] (4 PDB entries)

8. Domain d2c80b2: 2c80 B:4-84 [130092]
   Other proteins in same PDB: d2c80a1, d2c80b1
   automated match to d1oe8a2
   complexed with gtx, pg4

Details for d2c80b2

PDB Entry: 2c80, 2.3 Å

PDB Description: Structure of Sh28GST in complex with S-hexyl Glutathione

PDB Compounds: (B:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2c80b2:

Sequence; same for both SEQRES and ATOM records:

>d2c80b2 c.47.1.5 (B:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
dhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
hvkwmveslaiarymakkhhm

Timeline for d2c80b2:

• d2c80b2 first appeared in SCOP 1.73
  
• d2c80b2 appears in SCOPe 2.03
  
• d2c80b2 appears in SCOPe 2.05
  
• d2c80b2 appears in the current release, SCOPe 2.08