| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class alpha GST [81349] (8 species) |
| Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (8 PDB entries) |
| Domain d2c80a1: 2c80 A:85-207 [130089] Other proteins in same PDB: d2c80a2, d2c80b2 automatically matched to d1oe7a1 complexed with gtx, pg4 |
PDB Entry: 2c80 (more details), 2.3 Å
SCOPe Domain Sequences for d2c80a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c80a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
dra
Timeline for d2c80a1: