![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
![]() | Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins) automatically mapped to Pfam PF00145 |
![]() | Protein automated matches [190244] (3 species) not a true protein |
![]() | Species Haemophilus haemolyticus [TaxId:726] [187017] (6 PDB entries) |
![]() | Domain d2c7qa_: 2c7q A: [130081] automated match to d10mha_ protein/DNA complex; complexed with cit, sah, so4 |
PDB Entry: 2c7q (more details), 1.85 Å
SCOPe Domain Sequences for d2c7qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7qa_ c.66.1.26 (A:) automated matches {Haemophilus haemolyticus [TaxId: 726]} mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk qfgnsvvinvlqyiaynigsslnfkpy
Timeline for d2c7qa_: