SCOPe 2.08: Domain d2c75b2: 2c75 B:290-401

Lineage for d2c75b2 (2c75 B:290-401)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Monoamine oxidase B [69673] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69674] (46 PDB entries)

8. Domain d2c75b2: 2c75 B:290-401 [130029]
   Other proteins in same PDB: d2c75a1, d2c75b1
   automatically matched to d1o5wa2
   complexed with fad, rsa; mutant

Details for d2c75b2

PDB Entry: 2c75, 1.7 Å

PDB Description: functional role of the aromatic cage in human monoamine oxidase b: structures and catalytic properties of tyr435 mutant proteins

PDB Compounds: (B:) amine oxidase (flavin-containing) b

SCOPe Domain Sequences for d2c75b2:

Sequence; same for both SEQRES and ATOM records:

>d2c75b2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

Timeline for d2c75b2:

• d2c75b2 first appeared in SCOP 1.73
  
• d2c75b2 appears in SCOPe 2.07