Lineage for d2c75a2 (2c75 A:290-401)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935459Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 2935512Protein Monoamine oxidase B [69673] (2 species)
  7. 2935513Species Human (Homo sapiens) [TaxId:9606] [69674] (46 PDB entries)
  8. 2935524Domain d2c75a2: 2c75 A:290-401 [130027]
    Other proteins in same PDB: d2c75a1, d2c75b1
    automatically matched to d1o5wa2
    complexed with fad, rsa; mutant

Details for d2c75a2

PDB Entry: 2c75 (more details), 1.7 Å

PDB Description: functional role of the aromatic cage in human monoamine oxidase b: structures and catalytic properties of tyr435 mutant proteins
PDB Compounds: (A:) amine oxidase (flavin-containing) b

SCOPe Domain Sequences for d2c75a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c75a2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOPe Domain Coordinates for d2c75a2:

Click to download the PDB-style file with coordinates for d2c75a2.
(The format of our PDB-style files is described here.)

Timeline for d2c75a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c75a1