Lineage for d2c6ya_ (2c6y A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721762Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 1721783Protein automated matches [190243] (2 species)
    not a true protein
  7. 1721784Species Human (Homo sapiens) [TaxId:9606] [187016] (7 PDB entries)
  8. 1721788Domain d2c6ya_: 2c6y A: [130011]
    automated match to d1jxsa_
    complexed with mg

Details for d2c6ya_

PDB Entry: 2c6y (more details), 2.4 Å

PDB Description: crystal structure of interleukin enhancer-binding factor 1 bound to dna
PDB Compounds: (A:) forkhead box protein k2

SCOPe Domain Sequences for d2c6ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c6ya_ a.4.5.14 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dskppysyaqlivqaitmapdkqltlngiythitknypyyrtadkgwqnsirhnlslnry
fikvprsqeepgkgsfwridpasesklieqafrkrrpr

SCOPe Domain Coordinates for d2c6ya_:

Click to download the PDB-style file with coordinates for d2c6ya_.
(The format of our PDB-style files is described here.)

Timeline for d2c6ya_: