Lineage for d2c5vd1 (2c5v D:181-308)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772181Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 772182Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 772183Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 772194Protein Cyclin A [47956] (2 species)
  7. 772195Species Cow (Bos taurus) [TaxId:9913] [47958] (25 PDB entries)
  8. 772288Domain d2c5vd1: 2c5v D:181-308 [129956]
    Other proteins in same PDB: d2c5va1, d2c5vc1
    automatically matched to d1vin_1
    complexed with ab7, ck4, nh2, pff

Details for d2c5vd1

PDB Entry: 2c5v (more details), 2.9 Å

PDB Description: differential binding of inhibitors to active and inactive cdk2 provides insights for drug design
PDB Compounds: (D:) cyclin a2

SCOP Domain Sequences for d2c5vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5vd1 a.74.1.1 (D:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

SCOP Domain Coordinates for d2c5vd1:

Click to download the PDB-style file with coordinates for d2c5vd1.
(The format of our PDB-style files is described here.)

Timeline for d2c5vd1: