Lineage for d2c5vb2 (2c5v B:310-432)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331205Protein Cyclin A [47956] (2 species)
  7. 2331247Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
    Uniprot P20248 175-432
  8. 2331581Domain d2c5vb2: 2c5v B:310-432 [129954]
    Other proteins in same PDB: d2c5va_, d2c5vc_
    automated match to d1h27b2
    complexed with ck4

Details for d2c5vb2

PDB Entry: 2c5v (more details), 2.9 Å

PDB Description: differential binding of inhibitors to active and inactive cdk2 provides insights for drug design
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2c5vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5vb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d2c5vb2:

Click to download the PDB-style file with coordinates for d2c5vb2.
(The format of our PDB-style files is described here.)

Timeline for d2c5vb2: