Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.308: THUMP domain [143436] (1 superfamily) contains mixed 8-stranded beta-sheet, folded into a half-barrel and covered with 4 helices on the outside; order 32148756; strands 5, 6 and 7 are parallel |
Superfamily d.308.1: THUMP domain-like [143437] (3 families) predicted RNA-binding function |
Family d.308.1.1: THUMP domain [143438] (2 proteins) Pfam PF02926 |
Protein Thiamine biosynthesis protein ThiI, N-terminal domain [143439] (1 species) |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [143440] (1 PDB entry) Uniprot Q81KU0 3-173 |
Domain d2c5sa2: 2c5s A:3-173 [129951] Other proteins in same PDB: d2c5sa1 complexed with amp |
PDB Entry: 2c5s (more details), 2.5 Å
SCOPe Domain Sequences for d2c5sa2:
Sequence, based on SEQRES records: (download)
>d2c5sa2 d.308.1.1 (A:3-173) Thiamine biosynthesis protein ThiI, N-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} yeyilvrygemttkgknrskfvstlkdnvkfklkkfpnikidathdrmyiqlngedheav serlkdvfgihkfnlamkvpseledikkgalaaflqvkgdvktfkitvhrsykhfpmrtm ellpeigghilenteditvdvhnpdvnvrveirsgysyimcdermgagglp
>d2c5sa2 d.308.1.1 (A:3-173) Thiamine biosynthesis protein ThiI, N-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} yeyilvrygemgknrskfvstlkdnvkfklkkfpnikidathdrmyiqlngedheavser lkdvfgihkfnlamkvpseledikkgalaaflqvkgdvktfkitvhrsykhfpmrtmell peigghilenteditvdvhnpdvnvrveirsgysyimcdermgagglp
Timeline for d2c5sa2: