SCOPe 2.08: Domain d2c5sa2: 2c5s A:3-173

Lineage for d2c5sa2 (2c5s A:3-173)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.308: THUMP domain [143436] (1 superfamily)
   contains mixed 8-stranded beta-sheet, folded into a half-barrel and covered with 4 helices on the outside; order 32148756; strands 5, 6 and 7 are parallel

4. Superfamily d.308.1: THUMP domain-like [143437] (3 families)
   predicted RNA-binding function

5. Family d.308.1.1: THUMP domain [143438] (2 proteins)
   Pfam PF02926

6. Protein Thiamine biosynthesis protein ThiI, N-terminal domain [143439] (1 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [143440] (1 PDB entry)
   Uniprot Q81KU0 3-173

8. Domain d2c5sa2: 2c5s A:3-173 [129951]
   Other proteins in same PDB: d2c5sa1
   complexed with amp

Details for d2c5sa2

PDB Entry: 2c5s, 2.5 Å

PDB Description: crystal structure of bacillus anthracis thii, a trna-modifying enzyme containing the predicted rna-binding thump domain

PDB Compounds: (A:) probable thiamine biosynthesis protein thii

SCOPe Domain Sequences for d2c5sa2:

Sequence, based on SEQRES records:

>d2c5sa2 d.308.1.1 (A:3-173) Thiamine biosynthesis protein ThiI, N-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
yeyilvrygemttkgknrskfvstlkdnvkfklkkfpnikidathdrmyiqlngedheav
serlkdvfgihkfnlamkvpseledikkgalaaflqvkgdvktfkitvhrsykhfpmrtm
ellpeigghilenteditvdvhnpdvnvrveirsgysyimcdermgagglp

Sequence, based on observed residues (ATOM records):

>d2c5sa2 d.308.1.1 (A:3-173) Thiamine biosynthesis protein ThiI, N-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
yeyilvrygemgknrskfvstlkdnvkfklkkfpnikidathdrmyiqlngedheavser
lkdvfgihkfnlamkvpseledikkgalaaflqvkgdvktfkitvhrsykhfpmrtmell
peigghilenteditvdvhnpdvnvrveirsgysyimcdermgagglp

Timeline for d2c5sa2:

• d2c5sa2 first appeared in SCOP 1.73
  
• d2c5sa2 appears in SCOPe 2.07