Lineage for d2c5sa2 (2c5s A:3-173)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216132Fold d.308: THUMP domain [143436] (1 superfamily)
    contains mixed 8-stranded beta-sheet, folded into a half-barrel and covered with 4 helices on the outside; order 32148756; strands 5, 6 and 7 are parallel
  4. 2216133Superfamily d.308.1: THUMP domain-like [143437] (3 families) (S)
    predicted RNA-binding function
  5. 2216134Family d.308.1.1: THUMP domain [143438] (2 protein domains)
    Pfam PF02926
  6. 2216139Protein Thiamine biosynthesis protein ThiI, N-terminal domain [143439] (1 species)
  7. 2216140Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [143440] (1 PDB entry)
    Uniprot Q81KU0 3-173
  8. 2216141Domain d2c5sa2: 2c5s A:3-173 [129951]
    Other proteins in same PDB: d2c5sa1
    complexed with amp

Details for d2c5sa2

PDB Entry: 2c5s (more details), 2.5 Å

PDB Description: crystal structure of bacillus anthracis thii, a trna-modifying enzyme containing the predicted rna-binding thump domain
PDB Compounds: (A:) probable thiamine biosynthesis protein thii

SCOPe Domain Sequences for d2c5sa2:

Sequence, based on SEQRES records: (download)

>d2c5sa2 d.308.1.1 (A:3-173) Thiamine biosynthesis protein ThiI, N-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
yeyilvrygemttkgknrskfvstlkdnvkfklkkfpnikidathdrmyiqlngedheav
serlkdvfgihkfnlamkvpseledikkgalaaflqvkgdvktfkitvhrsykhfpmrtm
ellpeigghilenteditvdvhnpdvnvrveirsgysyimcdermgagglp

Sequence, based on observed residues (ATOM records): (download)

>d2c5sa2 d.308.1.1 (A:3-173) Thiamine biosynthesis protein ThiI, N-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
yeyilvrygemgknrskfvstlkdnvkfklkkfpnikidathdrmyiqlngedheavser
lkdvfgihkfnlamkvpseledikkgalaaflqvkgdvktfkitvhrsykhfpmrtmell
peigghilenteditvdvhnpdvnvrveirsgysyimcdermgagglp

SCOPe Domain Coordinates for d2c5sa2:

Click to download the PDB-style file with coordinates for d2c5sa2.
(The format of our PDB-style files is described here.)

Timeline for d2c5sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c5sa1