Lineage for d2c4ya_ (2c4y A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659798Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1659799Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1659800Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1659849Protein MS2 virus coat protein [55407] (1 species)
  7. 1659850Species Bacteriophage MS2 [TaxId:12022] [55408] (28 PDB entries)
    Uniprot P03612
  8. 1659870Domain d2c4ya_: 2c4y A: [129864]
    automated match to d1dzsa_
    protein/RNA complex

Details for d2c4ya_

PDB Entry: 2c4y (more details), 2.68 Å

PDB Description: ms2-rna hairpin (2thiouracil-5) complex
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d2c4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4ya_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d2c4ya_:

Click to download the PDB-style file with coordinates for d2c4ya_.
(The format of our PDB-style files is described here.)

Timeline for d2c4ya_: