SCOPe 2.02: Domain d2c4uc1: 2c4u C:193-298

Lineage for d2c4uc1 (2c4u C:193-298)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (1 family)

5. Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [101855] (14 PDB entries)

8. Domain d2c4uc1: 2c4u C:193-298 [129855]
   Other proteins in same PDB: d2c4ua2, d2c4ub2, d2c4uc2, d2c4ud2, d2c4ue2, d2c4uf2
   automatically matched to d1rqpa1
   complexed with gol

Details for d2c4uc1

PDB Entry: 2c4u, 2.5 Å

PDB Description: crystal structure of the apo form of the 5'-fluoro-5'-deoxyadenosine synthase enzyme from streptomyces cattleya

PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2c4uc1:

Sequence; same for both SEQRES and ATOM records:

>d2c4uc1 b.141.1.1 (C:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

Timeline for d2c4uc1:

• d2c4uc1 first appeared in SCOP 1.73
  
• d2c4uc1 appears in SCOPe 2.01
  
• d2c4uc1 appears in SCOPe 2.03
  
• d2c4uc1 appears in the current release, SCOPe 2.08