| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class mu GST [81348] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries) Uniprot P09488 P28161 |
| Domain d2c4jc1: 2c4j C:86-218 [129820] Other proteins in same PDB: d2c4ja2, d2c4jb2, d2c4jc2, d2c4jd2 automatically matched to d1hna_1 complexed with gso; mutant |
PDB Entry: 2c4j (more details), 1.35 Å
SCOPe Domain Sequences for d2c4jc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4jc1 a.45.1.1 (C:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk
Timeline for d2c4jc1: