SCOPe 2.08: Domain d2c3ua2: 2c3u A:786-1232

Lineage for d2c3ua2 (2c3u A:786-1232)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.12: PFOR PP module [88771] (1 protein)
   domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains

6. Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI [88772] (1 species)

7. Species Desulfovibrio africanus [TaxId:873] [88773] (10 PDB entries)

8. Domain d2c3ua2: 2c3u A:786-1232 [129771]
   Other proteins in same PDB: d2c3ua1, d2c3ua3, d2c3ua4, d2c3ua5, d2c3ub1, d2c3ub3, d2c3ub4, d2c3ub5
   automated match to d1keka2
   complexed with 2tp, ca, mg, pyr, sf4

Details for d2c3ua2

PDB Entry: 2c3u, 2.32 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus, oxygen inhibited form

PDB Compounds: (A:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d2c3ua2:

Sequence; same for both SEQRES and ATOM records:

>d2c3ua2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]}
vksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcssiwg
asapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesdasgd
vkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifggdgw
aydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtgkkdl
armvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmgksqd
vmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsfpeda
krlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtpmmar
pdsgeacdqnragtseqqgdlskrtkk

Timeline for d2c3ua2:

• d2c3ua2 first appeared in SCOP 1.73
  
• d2c3ua2 appears in SCOPe 2.07