![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species) |
![]() | Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries) |
![]() | Domain d2c3ub5: 2c3u B:669-785 [129779] Other proteins in same PDB: d2c3ua1, d2c3ua2, d2c3ua3, d2c3ua4, d2c3ub1, d2c3ub2, d2c3ub3, d2c3ub4 automated match to d1keka5 complexed with 2tp, ca, mg, pyr, sf4 |
PDB Entry: 2c3u (more details), 2.32 Å
SCOPe Domain Sequences for d2c3ub5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3ub5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip
Timeline for d2c3ub5: