SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2c3ub5 (2c3u B:669-785)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172289Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2172425Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 protein domains)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2172532Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 2172533Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries)
  8. 2172545Domain d2c3ub5: 2c3u B:669-785 [129779]
    Other proteins in same PDB: d2c3ua1, d2c3ua2, d2c3ua3, d2c3ua4, d2c3ub1, d2c3ub2, d2c3ub3, d2c3ub4
    automated match to d1keka5
    complexed with 2tp, ca, mg, pyr, sf4

Details for d2c3ub5

PDB Entry: 2c3u (more details), 2.32 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus, oxygen inhibited form
PDB Compounds: (B:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d2c3ub5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3ub5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOPe Domain Coordinates for d2c3ub5:

Click to download the PDB-style file with coordinates for d2c3ub5.
(The format of our PDB-style files is described here.)

Timeline for d2c3ub5: