Lineage for d2c3pa1 (2c3p A:2-258)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162387Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1162388Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1162640Family c.36.1.8: PFOR Pyr module [88746] (1 protein)
    domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains
  6. 1162641Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain I [88747] (1 species)
  7. 1162642Species Desulfovibrio africanus [TaxId:873] [88748] (10 PDB entries)
  8. 1162651Domain d2c3pa1: 2c3p A:2-258 [129760]
    Other proteins in same PDB: d2c3pa2, d2c3pa3, d2c3pa4, d2c3pa5, d2c3pb2, d2c3pb3, d2c3pb4, d2c3pb5
    automatically matched to d1b0pa1
    complexed with 1tp, ca, mg, sf4

Details for d2c3pa1

PDB Entry: 2c3p (more details), 2.33 Å

PDB Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (A:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d2c3pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3pa1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]}
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsy

SCOPe Domain Coordinates for d2c3pa1:

Click to download the PDB-style file with coordinates for d2c3pa1.
(The format of our PDB-style files is described here.)

Timeline for d2c3pa1: