![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82313] (1 species) |
![]() | Species Xanthobacter sp., py2 [TaxId:35809] [82314] (4 PDB entries) |
![]() | Domain d2c3ca2: 2c3c A:193-313 [129726] Other proteins in same PDB: d2c3ca3, d2c3cb3 automatically matched to d1mo9a2 complexed with acn, com, fad, nap |
PDB Entry: 2c3c (more details), 2.15 Å
SCOPe Domain Sequences for d2c3ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3ca2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} gvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtvmlvrteplkli kdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngemrietdfvflgl g
Timeline for d2c3ca2: