Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families) |
Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (1 protein) duplication: consists of two clear structural repeats each having this fold |
Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species) |
Species Leishmania major [TaxId:5664] [143126] (1 PDB entry) Trypanothione-dependent glyoxalase i |
Domain d2c21d1: 2c21 D:3-141 [129652] automatically matched to 2C21 A:3-141 complexed with mpd, mrd, na, ni |
PDB Entry: 2c21 (more details), 2 Å
SCOP Domain Sequences for d2c21d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c21d1 d.32.1.1 (D:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell nektmmekaeadmkeqgta
Timeline for d2c21d1: