SCOP 1.73: Domain d2c21f1: 2c21 F:3-141

Lineage for d2c21f1 (2c21 F:3-141)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families)

5. Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (1 protein)
   duplication: consists of two clear structural repeats each having this fold

6. Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species)

7. Species Leishmania major [TaxId:5664] [143126] (1 PDB entry)
   Trypanothione-dependent glyoxalase i

8. Domain d2c21f1: 2c21 F:3-141 [129654]
   automatically matched to 2C21 A:3-141
   complexed with mpd, mrd, na, ni

Details for d2c21f1

PDB Entry: 2c21, 2 Å

PDB Description: specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme

PDB Compounds: (F:) trypanothione-dependent glyoxalase I

SCOP Domain Sequences for d2c21f1:

Sequence; same for both SEQRES and ATOM records:

>d2c21f1 d.32.1.1 (F:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]}
srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty
nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell
nektmmekaeadmkeqgta

Timeline for d2c21f1:

• d2c21f1 is new in SCOP 1.73
  
• d2c21f1 appears in SCOP 1.75
  
• d2c21f1 appears in the current release, SCOPe 2.08, called d2c21f_