Lineage for d2c1ja_ (2c1j A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279239Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 1279240Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 1279286Protein automated matches [190238] (5 species)
    not a true protein
  7. 1279295Species Human (Homo sapiens) [TaxId:9606] [187008] (37 PDB entries)
  8. 1279340Domain d2c1ja_: 2c1j A: [129638]
    automated match to d1qjba_

Details for d2c1ja_

PDB Entry: 2c1j (more details), 2.6 Å

PDB Description: molecular basis for the recognition of phosphorylated and phosphoacetylated histone h3 by 14-3-3
PDB Compounds: (A:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d2c1ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1ja_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d2c1ja_:

Click to download the PDB-style file with coordinates for d2c1ja_.
(The format of our PDB-style files is described here.)

Timeline for d2c1ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c1jb_