Lineage for d2c1ja1 (2c1j A:1-230)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) 
Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) 
Family a.118.7.1: 14-3-3 protein [48446] (2 proteins) Protein zeta isoform [48449] (2 species) Species Human (Homo sapiens) [TaxId:9606] [48451] (5 PDB entries) 
Domain d2c1ja1: 2c1j A:1-230 [129638]
automatically matched to d1qjba_
Details for d2c1ja1
PDB Entry: 2c1j (more details), 2.6 Å
PDB Description: molecular basis for the recognition of phosphorylated and phosphoacetylated histone h3 by 14-3-3
PDB Compounds: (A:) 14-3-3 protein zeta/deltaSCOP Domain Sequences for d2c1ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c1ja1 a.118.7.1 (A:1-230) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
SCOP Domain Coordinates for d2c1ja1:
Click to download the PDB-style file with coordinates for d2c1ja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c1ja1:
- d2c1ja1 is new in SCOP 1.73
- d2c1ja1 appears in SCOP 1.75
- d2c1ja1 appears in the current release, SCOPe 2.08, called d2c1ja_
View in 3D
