Lineage for d2c0gb2 (2c0g B:1024-1145)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699757Family c.47.1.7: ERP29 N domain-like [52892] (2 proteins)
  6. 699761Protein Windbeutel, N-terminal domain [102444] (1 species)
  7. 699762Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102445] (5 PDB entries)
  8. 699764Domain d2c0gb2: 2c0g B:1024-1145 [129593]
    Other proteins in same PDB: d2c0ga1, d2c0gb1
    automatically matched to d1ovnb2
    complexed with cl, na; mutant

Details for d2c0gb2

PDB Entry: 2c0g (more details), 1.75 Å

PDB Description: Structure of PDI-related Chaperone, Wind mutant-Y53S
PDB Compounds: (B:) windbeutel protein

SCOP Domain Sequences for d2c0gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0gb2 c.47.1.7 (B:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ctgcvdldelsfektverfpysvvkfdiaspygekheaftafsksahkatkdlliatvgv
kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
ig

SCOP Domain Coordinates for d2c0gb2:

Click to download the PDB-style file with coordinates for d2c0gb2.
(The format of our PDB-style files is described here.)

Timeline for d2c0gb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c0gb1